/eh/2025-01-08/173633966714069467/picture.png)
/eh/2024-12-24/173503345348979036/Favorite-Icon.png){kind=icon}
/eh/2025-07-08/1751962110204480194/picture.png)
/eh/2025-06-21/1750485478958537574/countryInfoIcon.png)
/eh/2025-06-21/1750485741321434291/Hi-Sign-in-My-Nihao.png)
/eh/2025-06-21/1750485837193896318/cart.png)
/eh/2025-06-21/1750485968202533847/cart.png)
/eh/2025-04-17/1744862476612819675/hot-img.png)
/eh/2025-11-07/1762504524550532584/header-icon.jpg){kind=icon}
/eh/2025-07-07/1751875582852206790/header-icon.png){kind=icon}
/eh/2025-07-07/1751875587886277738/header-icon.png){kind=icon}
Best in 7 days
download picture
description
LL-37LL 37: Pioneering Antimicrobial Peptide for Research Advance Your Immunology Studies with LL 37 LL 37, a cathelicidin derived antimicrobial peptide, has emerged as a crucial focus in immunology and microbiology research. This multifunctional peptide offers exciting possibilities for studying innate immune responses and novel antimicrobial strategies. LL 37 Specifications: Sequence: [LL-37, 37 aa] Molecular Weight: 4493. 33 g mol
Shopping security
product description
Why choose thelockerguy wholesale?
LL-37
Item no
:
98017188105
US$ 65.00
Pay in 4 interest-free payments of $16.25 Learn more
Min. order:
1piece
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jun 19 - Jun 24
US$40
Get nowSign up to your membership to get coupons up to
15%
Get nowOpportunity to enjoy order discount up to 15% off
Please add the products
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
Discover Niche Categories That Outsell
Top-Converting Item to Boost Your Average Order
Best in 7 days
Best in 7 days
Best in 7 days
Best in 7 days
recommand products
